OPENSEQ.org - GSPM - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

GSPM - Putative type II secretion system protein M

UniProt:	P36678	Sequence MIKSWWAEKSTSEKQIVAALAVLSLGVFCWLGVIKPIDTYIAEHQSHAQKIKKDIKWMQDQASTHGLLGHPALTQPIKNILLEEAKRENLAITLENGPDNTLTIHPVTAPLENVSRWLTTAQVTYGIVIEDLQFTLAGNEEITLRHLSFREQQ	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12173
Length:	153 (145)
Sequences:	227
Seq/Len:	1.57

GSPM
Paralog alert: 0.22 [within 20: 0.00] - ratio of genomes with paralogs
Cluster includes: GSPM YGHD

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
28_F	32_G	2.25	0.99
9_K	17_V	2.22	0.99
16_I	20_L	1.814	0.96
13_E	16_I	1.772	0.95
90_L	102_L	1.658	0.93
28_F	109_A	1.555	0.89
23_L	26_G	1.475	0.86
25_L	29_C	1.464	0.85
8_E	66_G	1.417	0.83
43_E	118_L	1.413	0.82
58_M	91_A	1.357	0.79
5_W	14_K	1.352	0.78
16_I	96_N	1.35	0.78
106_P	123_V	1.346	0.78
85_A	121_A	1.328	0.77
6_W	52_K	1.325	0.76
85_A	102_L	1.316	0.76
14_K	52_K	1.312	0.75
60_D	129_I	1.303	0.75
94_L	97_G	1.296	0.74
86_K	113_N	1.278	0.73
100_N	144_L	1.269	0.72
30_W	34_I	1.251	0.70
42_A	68_L	1.229	0.68
14_K	97_G	1.219	0.67
64_T	69_G	1.214	0.67
17_V	89_N	1.211	0.67
118_L	129_I	1.203	0.66
26_G	30_W	1.197	0.65
2_I	16_I	1.196	0.65
134_F	142_I	1.189	0.65
65_H	78_K	1.187	0.64
23_L	72_A	1.18	0.64
104_I	111_L	1.179	0.64
96_N	140_E	1.178	0.64
28_F	39_T	1.175	0.63
55_I	67_L	1.158	0.62
5_W	114_V	1.151	0.61
19_A	33_V	1.149	0.61
79_N	133_Q	1.139	0.60
26_G	106_P	1.122	0.58
19_A	89_N	1.117	0.57
54_D	110_P	1.116	0.57
107_V	143_T	1.114	0.57
100_N	122_Q	1.107	0.56
77_I	103_T	1.106	0.56
9_K	145_R	1.089	0.55
2_I	99_D	1.086	0.54
111_L	134_F	1.085	0.54
26_G	116_R	1.084	0.54
14_K	79_N	1.068	0.52
66_G	120_T	1.066	0.52
56_K	129_I	1.064	0.52
114_V	142_I	1.062	0.52
37_I	109_A	1.056	0.51
23_L	75_Q	1.048	0.50
48_A	96_N	1.044	0.50
14_K	101_T	1.04	0.49
39_T	134_F	1.029	0.48
57_W	97_G	1.028	0.48
58_M	68_L	1.027	0.48
23_L	27_V	1.025	0.48
22_V	29_C	1.024	0.48
71_P	89_N	1.023	0.48
47_H	110_P	1.022	0.48
43_E	114_V	1.022	0.48
3_K	70_H	1.016	0.47
90_L	106_P	1.016	0.47
14_K	82_L	1.012	0.47
81_L	125_Y	1.011	0.46
34_I	75_Q	1.006	0.46
67_L	103_T	1.005	0.46
4_S	14_K	1.002	0.46

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1uv7A	2	0.6209	99.9	0.447	Contact Map	0.256
2rjzA	2	0.7516	75.7	0.889	Contact Map	0.215
4e9jA	2	0.4314	17.1	0.926	Contact Map	0.415
2rddB	1	0.2418	12.4	0.93	Contact Map	0.426
3hd7A	2	0.2092	9.2	0.934	Contact Map	0.478
2w7vA	2	0.5425	7.1	0.938	Contact Map	0.356
2eefA	1	0.3987	6	0.94	Contact Map	0
3ossD	1	0.3464	5.1	0.942	Contact Map	0.375
2y3mA	2	0.5425	4.3	0.944	Contact Map	0.129
4bhqA	2	0.732	4.2	0.944	Contact Map	0.162

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.3108 seconds.