OPENSEQ.org - PPTA - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

PPTA - Tautomerase PptA

UniProt:	P31992	Sequence MPHIDIKCFPRELDEQQKAALAADITDVIIRHLNSKDSSISIALQQIQPESWQAIWDAEIAPQMEALIKKPGYSMNA	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11761
Length:	77 (75)
Sequences:	79
Seq/Len:	1.05

PPTA
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
4_I	47_I	2.164	0.98
19_A	23_A	2.02	0.96
38_S	50_E	1.716	0.89
42_I	46_Q	1.67	0.87
16_Q	55_I	1.662	0.87
38_S	49_P	1.617	0.85
21_L	25_I	1.533	0.80
18_K	69_K	1.519	0.79
5_D	59_E	1.489	0.77
12_E	15_E	1.482	0.77
22_A	33_L	1.467	0.76
3_H	7_K	1.453	0.75
2_P	7_K	1.453	0.75
20_A	35_S	1.397	0.71
12_E	46_Q	1.386	0.70
26_T	58_A	1.339	0.66
51_S	54_A	1.332	0.65
35_S	70_K	1.301	0.63
16_Q	54_A	1.273	0.60
11_R	44_L	1.223	0.56
40_I	51_S	1.212	0.55
21_L	43_A	1.194	0.53
53_Q	75_M	1.19	0.52
26_T	37_D	1.19	0.52
18_K	42_I	1.189	0.52
18_K	21_L	1.189	0.52
15_E	70_K	1.166	0.50
47_I	58_A	1.114	0.45
14_D	55_I	1.103	0.44
10_P	46_Q	1.091	0.43
34_N	58_A	1.072	0.41
53_Q	61_A	1.071	0.41
19_A	65_E	1.062	0.41
29_I	53_Q	1.057	0.40
4_I	30_I	1.052	0.40
6_I	9_F	1.05	0.39
22_A	42_I	1.043	0.39
38_S	47_I	1.041	0.39
15_E	47_I	1.031	0.38
44_L	75_M	1.026	0.37
17_Q	51_S	1.025	0.37
44_L	59_E	1.017	0.37
9_F	35_S	1.007	0.36

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1gyxA	2	0.987	99.8	0.418	Contact Map	0.187
4jcuA	3	0.7922	98.9	0.658	Contact Map	0.215
1u9dA	2	0.6883	98.8	0.662	Contact Map	0.105
3mb2B	6	0.9091	98.8	0.668	Contact Map	0.174
3e6qA	12	0.7922	98.7	0.67	Contact Map	0.141
3abfA	6	0.8052	98.7	0.673	Contact Map	0.248
1otgA	3	0.7792	98.7	0.673	Contact Map	0.166
2x4kA	2	0.7662	98.7	0.679	Contact Map	0.254
3ej9A	3	0.9221	98.6	0.682	Contact Map	0.149
3mb2A	6	0.9091	98.6	0.683	Contact Map	0.202

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 1.1834 seconds.