OPENSEQ.org - CYAY - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

CYAY - Protein CyaY

UniProt:	P27838	Sequence MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGSKIIINRQEPLHQVWLATKQGGYHFDLKGDEWICDRSGETFWDLLEQAATQQAGETVSFR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11653
Length:	106 (106)
Sequences:	439
Seq/Len:	4.14

CYAY
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
59_Q	72_D	2.754	1.00
3_D	58_H	2.602	1.00
2_N	5_E	1.905	1.00
85_E	93_Q	1.84	1.00
86_T	89_D	1.8	1.00
6_F	55_E	1.74	0.99
66_Q	94_A	1.715	0.99
71_F	85_E	1.688	0.99
9_L	73_L	1.669	0.99
40_T	48_K	1.636	0.99
71_F	83_S	1.583	0.99
62_L	87_F	1.544	0.98
64_T	94_A	1.538	0.98
54_Q	57_L	1.53	0.98
63_A	68_G	1.459	0.97
93_Q	97_Q	1.455	0.97
12_Q	31_D	1.451	0.97
7_H	11_D	1.449	0.97
34_I	80_C	1.348	0.95
7_H	53_R	1.307	0.94
95_A	99_A	1.301	0.94
80_C	83_S	1.273	0.93
10_A	14_W	1.27	0.93
39_L	43_F	1.268	0.92
6_F	58_H	1.262	0.92
6_F	53_R	1.25	0.92
6_F	44_E	1.231	0.91
64_T	98_Q	1.204	0.90
37_G	59_Q	1.192	0.89
37_G	42_T	1.186	0.89
51_I	90_L	1.185	0.89
65_K	68_G	1.175	0.88
3_D	55_E	1.173	0.88
77_E	86_T	1.16	0.87
25_D	76_D	1.156	0.87
59_Q	81_D	1.156	0.87
44_E	47_S	1.136	0.86
22_D	32_C	1.13	0.85
18_E	25_D	1.124	0.85
37_G	57_L	1.121	0.85
38_V	67_G	1.109	0.84
39_L	82_R	1.108	0.84
33_E	55_E	1.089	0.82
16_T	102_T	1.089	0.82
64_T	67_G	1.064	0.80
73_L	79_I	1.061	0.80
21_L	24_W	1.056	0.79
19_E	40_T	1.049	0.79
13_L	69_Y	1.045	0.78
15_L	89_D	1.042	0.78
38_V	48_K	1.039	0.78
63_A	69_Y	1.02	0.76

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1ew4A	1	1	100	0.019	Contact Map	0.481
4jpdA	1	1	100	0.02	Contact Map	0.456
4hs5A	2	0.9811	100	0.029	Contact Map	0.545
3t3lA	1	1	100	0.041	Contact Map	0.477
3oeqA	1	0.9717	100	0.098	Contact Map	0.248
2pt7G	2	0.9245	13	0.929	Contact Map	0.095
4i66A	1	0.4057	11.6	0.93	Contact Map	0.184
1n10A	2	0.9717	10.4	0.932	Contact Map	0.119
4g08A	1	0.3302	8.5	0.934	Contact Map	0.739
1xkpB	1	0.783	8.4	0.935	Contact Map	0.221

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.9632 seconds.