OPENSEQ.org - HYAD - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

HYAD - Hydrogenase 1 maturation protease

UniProt:	P19930	Sequence MSEQRVVVMGLGNLLWADEGFGVRVAERLYAHYHWPEYVEIVDGGTQGLNLLGYVESASHLLILDAIDYGLEPGTLRTYAGERIPAYLSAKKMSLHQNSFSEVLALADIRGHLPAHIALVGLQPAMLDDYGGSLSELAREQLPAAEQAALAQLAAWGIVPQPANESRCLNYDCLSMENYEGVRLRQYRMTQEEQG	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10471
Length:	195 (163)
Sequences:	500
Seq/Len:	3.07

HYAD
Paralog alert: 0.57 [within 20: 0.01] - ratio of genomes with paralogs
Cluster includes: HYAD HYBD HYCI

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
125_A	137_L	4.909	1.00
64_L	149_A	2.736	1.00
26_A	41_I	2.688	1.00
62_L	156_W	2.01	1.00
25_V	64_L	1.955	1.00
24_R	27_E	1.92	0.99
68_D	123_Q	1.836	0.99
136_E	140_E	1.828	0.99
6_V	158_I	1.819	0.99
70_G	123_Q	1.761	0.99
120_V	145_A	1.746	0.99
60_H	116_H	1.731	0.99
56_E	112_H	1.715	0.99
78_T	152_Q	1.702	0.98
120_V	149_A	1.665	0.98
60_H	156_W	1.581	0.97
21_F	122_L	1.557	0.97
78_T	120_V	1.552	0.97
100_F	103_V	1.548	0.97
126_M	129_D	1.509	0.96
122_L	138_A	1.464	0.95
138_A	141_Q	1.456	0.95
64_L	145_A	1.45	0.95
19_E	124_P	1.444	0.95
126_M	135_S	1.423	0.94
23_V	124_P	1.398	0.93
36_P	39_V	1.393	0.93
49_L	106_L	1.373	0.92
62_L	149_A	1.364	0.92
5_R	59_S	1.35	0.92
35_W	150_L	1.337	0.91
28_R	32_H	1.336	0.91
69_Y	77_R	1.324	0.91
136_E	139_R	1.317	0.90
63_I	100_F	1.316	0.90
31_A	163_A	1.302	0.90
161_Q	164_N	1.296	0.89
148_A	151_A	1.29	0.89
14_L	122_L	1.273	0.88
26_A	64_L	1.255	0.87
7_V	42_V	1.253	0.87
69_Y	123_Q	1.238	0.86
14_L	19_E	1.228	0.86
67_I	121_G	1.224	0.85
160_P	163_A	1.202	0.84
152_Q	156_W	1.199	0.84
19_E	24_R	1.194	0.83
141_Q	144_A	1.19	0.83
122_L	145_A	1.182	0.82
144_A	148_A	1.133	0.79
20_G	131_G	1.121	0.78
40_E	58_A	1.112	0.77
52_L	67_I	1.111	0.77
150_L	160_P	1.107	0.76
124_P	127_L	1.096	0.75
24_R	133_S	1.093	0.75
7_V	58_A	1.093	0.75
14_L	23_V	1.092	0.75
80_A	83_R	1.064	0.72
152_Q	155_A	1.062	0.72
59_S	115_A	1.062	0.72
110_R	142_L	1.062	0.72
46_T	61_L	1.059	0.72
6_V	39_V	1.058	0.72
34_H	161_Q	1.057	0.71
79_Y	95_L	1.054	0.71
116_H	156_W	1.052	0.71
63_I	117_I	1.049	0.71
62_L	118_A	1.049	0.71
23_V	43_D	1.039	0.70
6_V	60_H	1.026	0.68
77_R	123_Q	1.023	0.68
28_R	146_E	1.022	0.68
17_A	126_M	1.014	0.67
143_P	146_E	1.011	0.67
158_I	163_A	1.009	0.66
15_L	44_G	1.005	0.66
25_V	142_L	1.005	0.66

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1cfzA	6	0.8256	100	0.324	Contact Map	0.63
2e85A	2	0.8051	100	0.421	Contact Map	0.584
3pu6A	1	0.7795	100	0.439	Contact Map	0.537
1c8bA	2	0.9795	95	0.902	Contact Map	0.507
3triA	2	0.8974	67	0.935	Contact Map	0.382
2hk9A	4	0.6974	63.4	0.936	Contact Map	0.448
3svlA	2	0.8205	61.7	0.937	Contact Map	0.466
3rofA	1	0.5949	61.6	0.937	Contact Map	0.326
4egsA	2	0.5692	59.8	0.938	Contact Map	0.464
3jviA	1	0.6154	54.1	0.94	Contact Map	0.426

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.3875 seconds.