OPENSEQ.org - INSJ - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

INSJ - Insertion element IS150 uncharacterized 19.7 kDa protein

UniProt:	P19768	Sequence MSKPKYPFEKRLEVVNHYFTTDDGYRIISARFGVPRTQVRTWVALYEKHGEKGLIPKPKGVSADPELRIKVVKAVIEQHMSLNQAAAHFMLAGSGSVARWLKVYEERGEAGLRALKIGTKRNIAISVDPEKAASALELSKDRRIEDLERQVRFLETRLMYLKKLKALAHPTKK	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG40010
Length:	173 (169)
Sequences:	407
Seq/Len:	2.41

INSJ
Paralog alert: 0.35 [within 20: 0.02] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
150_Q	155_E	5.124	1.00
71_V	89_F	2.74	1.00
157_R	162_K	2.291	1.00
107_R	111_G	2.081	1.00
14_V	39_V	2.059	0.99
72_V	101_L	2.03	0.99
154_L	158_L	1.989	0.99
153_F	156_T	1.95	0.99
71_V	97_V	1.937	0.99
165_K	169_H	1.88	0.99
165_K	168_A	1.88	0.99
151_V	155_E	1.836	0.99
67_L	71_V	1.803	0.98
108_G	112_L	1.789	0.98
75_V	85_A	1.778	0.98
144_I	148_E	1.762	0.98
163_K	166_A	1.749	0.98
143_R	146_D	1.742	0.98
160_Y	164_L	1.736	0.98
157_R	161_L	1.663	0.97
158_L	161_L	1.654	0.97
14_V	28_I	1.623	0.96
17_H	32_F	1.603	0.96
6_Y	42_W	1.579	0.95
151_V	154_L	1.579	0.95
14_V	32_F	1.517	0.94
72_V	76_I	1.514	0.94
74_A	89_F	1.493	0.93
17_H	28_I	1.492	0.93
156_T	159_M	1.489	0.93
68_R	115_L	1.465	0.92
63_A	68_R	1.45	0.92
152_R	155_E	1.428	0.91
28_I	32_F	1.421	0.91
17_H	31_R	1.421	0.91
6_Y	10_K	1.393	0.90
10_K	14_V	1.392	0.90
50_G	54_L	1.386	0.89
144_I	151_V	1.366	0.88
28_I	39_V	1.362	0.88
164_L	167_L	1.303	0.85
151_V	158_L	1.3	0.85
74_A	78_Q	1.293	0.85
112_L	118_G	1.282	0.84
23_D	27_I	1.281	0.84
72_V	85_A	1.233	0.80
64_D	68_R	1.209	0.79
156_T	163_K	1.198	0.78
102_K	106_E	1.191	0.77
158_L	162_K	1.175	0.76
76_I	101_L	1.169	0.75
22_D	40_R	1.164	0.75
108_G	111_G	1.157	0.74
31_R	34_V	1.129	0.72
33_G	40_R	1.128	0.72
36_R	40_R	1.126	0.71
65_P	72_V	1.114	0.70
97_V	104_Y	1.114	0.70
143_R	148_E	1.103	0.69
75_V	101_L	1.088	0.68
142_R	148_E	1.074	0.66
25_Y	43_V	1.066	0.65
28_I	85_A	1.054	0.64
13_E	17_H	1.052	0.64
150_Q	153_F	1.05	0.64
15_V	18_Y	1.046	0.63
155_E	159_M	1.043	0.63
110_A	117_I	1.041	0.63
26_R	40_R	1.036	0.62
92_A	96_S	1.022	0.60
155_E	158_L	1.018	0.60
76_I	105_E	1.011	0.59
145_E	148_E	1.008	0.59
166_A	170_P	1.007	0.59
85_A	101_L	1.001	0.58
163_K	167_L	1.001	0.58
72_V	75_V	1	0.58
153_F	160_Y	1	0.58

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2rn7A	1	0.5491	99.5	0.694	Contact Map	0.262
2jn6A	1	0.5549	99.4	0.719	Contact Map	0.288
1pdnC	1	0.6012	99.2	0.738	Contact Map	0.578
2k27A	1	0.7283	99.2	0.744	Contact Map	0.413
1u78A	1	0.8035	99.2	0.748	Contact Map	0.627
1k78A	3	0.6358	99.1	0.749	Contact Map	0.706
1hlvA	1	0.6301	99.1	0.759	Contact Map	0.452
2lvsA	1	0.5954	99	0.76	Contact Map	0.308
2oa4A	1	0.4104	98.9	0.776	Contact Map	0.398
2elhA	1	0.4046	98.5	0.802	Contact Map	0.315

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 1.1196 seconds.