OPENSEQ.org - INSA3 - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

INSA3 - Insertion element IS1 3 protein InsA

UniProt:	P0CF09	Sequence MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTYTASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTIFRHLKNSGRSR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG60009
Length:	91 (91)
Sequences:	179
Seq/Len:	1.97

INSA3
Paralog alert: 0.43 [within 20: 0.08] - ratio of genomes with paralogs
Cluster includes: INSA1 INSA2 INSA3 INSA4 INSA5 INSA6 INSA7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
27_H	40_Q	2.18	1.00
78_N	82_R	1.939	0.99
21_G	35_C	1.774	0.97
59_M	62_N	1.662	0.95
84_L	87_S	1.59	0.94
52_T	55_K	1.589	0.94
57_I	60_A	1.546	0.92
2_A	6_I	1.516	0.91
74_G	78_N	1.481	0.90
8_C	35_C	1.461	0.89
14_T	26_G	1.396	0.86
63_G	79_T	1.388	0.86
29_R	38_T	1.388	0.86
59_M	72_I	1.336	0.83
35_C	71_R	1.322	0.82
62_N	71_R	1.312	0.81
43_F	53_H	1.308	0.81
64_V	72_I	1.301	0.80
77_L	83_H	1.292	0.80
58_D	72_I	1.28	0.79
65_G	68_A	1.261	0.77
21_G	32_C	1.26	0.77
68_A	84_L	1.231	0.75
43_F	48_S	1.227	0.75
62_N	68_A	1.22	0.74
32_C	35_C	1.212	0.73
63_G	67_R	1.209	0.73
21_G	30_Y	1.2	0.72
26_G	32_C	1.193	0.72
19_R	28_Q	1.184	0.71
21_G	28_Q	1.161	0.69
16_G	39_W	1.16	0.69
74_G	79_T	1.14	0.67
13_A	34_H	1.128	0.66
68_A	77_L	1.128	0.66
22_K	26_G	1.127	0.65
8_C	21_G	1.116	0.64
3_S	90_S	1.066	0.59
28_Q	32_C	1.056	0.58
60_A	83_H	1.044	0.57
81_F	85_K	1.031	0.55
15_D	91_R	1.025	0.55
59_M	76_G	1.022	0.54
40_Q	51_G	1.02	0.54
3_S	6_I	1.017	0.54
57_I	77_L	1.014	0.53
1_M	4_V	1.014	0.53
7_S	10_S	1.01	0.53
18_V	31_L	1.006	0.53
20_N	38_T	1.001	0.52

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2jn6A	1	0.5385	97.7	0.747	Contact Map	0.305
1u78A	1	0.5495	97.7	0.751	Contact Map	0.386
2rn7A	1	0.5495	97.4	0.764	Contact Map	0.268
1pdnC	1	0.6703	97.4	0.765	Contact Map	0.292
2k27A	1	0.7582	97.3	0.766	Contact Map	0.296
3o9xA	2	0.956	97.3	0.767	Contact Map	0.323
1tc3C	1	0.5385	97.3	0.767	Contact Map	0.323
2elhA	1	0.6813	97.3	0.767	Contact Map	0.244
4dyqA	2	0.6154	97.2	0.77	Contact Map	0.303
1jkoC	1	0.5385	97.2	0.771	Contact Map	0.202

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.283 seconds.