OPENSEQ.org - YAIE - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YAIE - UPF0345 protein YaiE

UniProt:	P0C037	Sequence MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGEYTFSTAEPEEMTVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVAEPTSYLCRYL	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12159
Length:	94 (94)
Sequences:	300
Seq/Len:	3.19

YAIE
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
38_S	93_Y	3.498	1.00
55_L	80_H	2.967	1.00
36_T	78_E	2.826	1.00
42_P	75_G	2.682	1.00
59_A	63_Q	2.384	1.00
53_N	82_Q	2.376	1.00
36_T	80_H	2.118	1.00
74_P	77_S	2.115	1.00
66_E	69_S	2.107	1.00
2_L	15_I	1.956	1.00
40_A	76_H	1.871	0.99
54_V	65_Y	1.859	0.99
6_E	13_K	1.702	0.99
44_E	94_L	1.665	0.98
12_V	33_G	1.529	0.97
57_P	78_E	1.492	0.96
42_P	94_L	1.478	0.96
55_L	60_T	1.458	0.95
12_V	35_Y	1.357	0.92
13_K	29_V	1.356	0.92
51_A	85_E	1.354	0.92
55_L	62_W	1.342	0.92
42_P	72_N	1.325	0.91
51_A	67_A	1.295	0.90
55_L	63_Q	1.283	0.89
47_V	87_T	1.21	0.85
8_F	45_M	1.198	0.84
52_L	81_L	1.196	0.84
35_Y	81_L	1.163	0.82
48_I	88_S	1.152	0.81
53_N	64_V	1.144	0.80
2_L	13_K	1.115	0.78
51_A	84_A	1.11	0.78
4_S	13_K	1.102	0.77
42_P	74_P	1.099	0.77
6_E	10_G	1.084	0.75
4_S	15_I	1.075	0.74
12_V	30_M	1.059	0.73
27_V	46_T	1.045	0.71
27_V	88_S	1.041	0.71
30_M	83_V	1.033	0.70
7_Y	93_Y	1.018	0.68
46_T	70_V	1.016	0.68
40_A	93_Y	1.003	0.67

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2oyzA	1	0.9894	100	0.055	Contact Map	0.59
3hqxA	1	1	100	0.063	Contact Map	0.721
3eo6A	2	0.9894	100	0.102	Contact Map	0.705
3es4A	2	0.9787	94.3	0.864	Contact Map	0.519
1yhfA	1	0.9681	94.2	0.864	Contact Map	0.66
3rnsA	1	0.9681	93.9	0.866	Contact Map	0.645
1v70A	1	0.9787	93.4	0.868	Contact Map	0.589
2f4pA	4	0.9787	93	0.87	Contact Map	0.53
2d5fA	2	0.9894	92.4	0.873	Contact Map	0.578
2ea7A	3	0.9894	92.4	0.873	Contact Map	0.597

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.6958 seconds.