OPENSEQ.org - YIBN - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YIBN - Uncharacterized protein YibN

UniProt:	P0AG27	Sequence MQEIMQFVGRHPILSIAWIALLVAVLVTTFKSLTSKVKVITRGEATRLINKEDAVVVDLRQRDDFRKGHIAGSINLLPSEIKANNVGELEKHKDKPVIVVDGSGMQCQEPANALTKAGFAQVFVLKEGVAGWAGENLPLVRGK	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12295
Length:	143 (143)
Sequences:	490
Seq/Len:	3.43

YIBN
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs
Cluster includes: GLPE PSPE YIBN

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
129_V	139_L	3.404	1.00
85_N	88_E	2.779	1.00
52_E	121_Q	2.259	1.00
6_Q	10_R	2.23	1.00
131_G	135_E	2.166	1.00
73_S	129_V	2.15	1.00
94_D	120_A	2.144	1.00
49_I	56_V	2.061	1.00
57_V	99_V	2.058	1.00
78_P	110_P	1.974	1.00
107_C	124_V	1.932	1.00
127_E	131_G	1.898	1.00
64_D	106_Q	1.835	0.99
59_L	106_Q	1.822	0.99
61_Q	79_S	1.77	0.99
68_G	141_R	1.696	0.99
81_I	110_P	1.671	0.99
101_D	106_Q	1.667	0.99
101_D	107_C	1.626	0.98
18_W	22_L	1.602	0.98
90_E	119_F	1.572	0.98
70_I	100_V	1.504	0.97
59_L	99_V	1.413	0.95
45_A	98_I	1.388	0.94
65_F	69_H	1.373	0.94
3_E	10_R	1.356	0.93
49_I	54_A	1.318	0.92
62_R	75_N	1.316	0.92
22_L	25_V	1.296	0.91
73_S	100_V	1.293	0.91
61_Q	106_Q	1.269	0.90
11_H	22_L	1.261	0.89
127_E	139_L	1.245	0.89
41_T	44_E	1.244	0.89
78_P	81_I	1.237	0.88
103_S	106_Q	1.226	0.88
57_V	108_Q	1.215	0.87
15_S	18_W	1.179	0.85
99_V	117_A	1.171	0.84
70_I	125_L	1.155	0.83
39_V	76_L	1.154	0.83
42_R	136_N	1.144	0.82
90_E	97_V	1.102	0.79
44_E	72_G	1.101	0.79
56_V	100_V	1.1	0.79
54_A	125_L	1.1	0.79
18_W	35_S	1.09	0.78
44_E	47_R	1.084	0.77
101_D	104_G	1.081	0.77
63_D	67_K	1.081	0.77
20_A	24_A	1.074	0.76
23_V	27_V	1.073	0.76
44_E	83_A	1.067	0.76
93_K	119_F	1.066	0.75
89_L	119_F	1.066	0.75
40_I	45_A	1.049	0.74
26_L	93_K	1.047	0.74
60_R	95_K	1.044	0.73
21_L	25_V	1.026	0.71
59_L	124_V	1.026	0.71
17_A	21_L	1.019	0.71
59_L	78_P	1.012	0.70
89_L	99_V	1	0.69

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3op3A	1	0.972	100	0.419	Contact Map	0.434
3emeA	1	0.7133	100	0.419	Contact Map	0.5
1qxnA	2	0.8741	99.9	0.422	Contact Map	0.473
1gmxA	1	0.7413	99.9	0.426	Contact Map	0.418
3fojA	1	0.6923	99.9	0.431	Contact Map	0.457
3gk5A	1	0.7203	99.9	0.434	Contact Map	0.646
2hhgA	1	0.8601	99.9	0.438	Contact Map	0.537
3ilmA	4	0.7133	99.9	0.439	Contact Map	0.626
3d1pA	1	0.8811	99.9	0.439	Contact Map	0.571
2k0zA	1	0.7273	99.9	0.444	Contact Map	0.598

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.5618 seconds.