OPENSEQ.org - ROF - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

ROF - Protein rof

UniProt:	P0AFW8	Sequence MNDTYQPINCDDYDNLELACQHHLMLTLELKDGEKLQAKASDLVSRKNVEYLVVEAAGETRELRLDKITSFSHPEIGTVVVSES	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13221
Length:	84 (84)
Sequences:	121
Seq/Len:	1.44

ROF
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
56_A	59_E	2.699	1.00
4_T	38_A	1.67	0.92
3_D	28_L	1.665	0.92
26_L	77_G	1.615	0.90
26_L	64_R	1.454	0.83
16_L	26_L	1.423	0.81
12_D	51_Y	1.384	0.78
1_M	76_I	1.382	0.78
4_T	37_Q	1.373	0.78
31_K	36_L	1.36	0.77
8_I	81_V	1.301	0.72
7_P	62_E	1.242	0.67
8_I	13_Y	1.226	0.66
14_D	20_C	1.214	0.64
55_E	58_G	1.213	0.64
29_E	37_Q	1.212	0.64
1_M	27_T	1.211	0.64
7_P	33_G	1.208	0.64
24_L	74_P	1.194	0.62
24_L	76_I	1.188	0.62
44_V	51_Y	1.187	0.62
43_L	84_S	1.178	0.61
76_I	84_S	1.177	0.61
27_T	68_I	1.176	0.61
55_E	84_S	1.146	0.58
44_V	52_L	1.141	0.57
15_N	61_R	1.138	0.57
4_T	31_K	1.127	0.56
43_L	54_V	1.126	0.56
9_N	12_D	1.125	0.56
24_L	41_S	1.117	0.55
64_R	77_G	1.108	0.54
44_V	62_E	1.106	0.54
53_V	56_A	1.102	0.53
22_H	30_L	1.101	0.53
45_S	49_V	1.095	0.53
25_M	75_E	1.093	0.52
25_M	54_V	1.088	0.52
66_D	78_T	1.083	0.51
39_K	55_E	1.066	0.50
2_N	38_A	1.062	0.49
22_H	75_E	1.055	0.49
52_L	64_R	1.044	0.47
43_L	76_I	1.042	0.47
40_A	79_V	1.03	0.46
1_M	83_E	1.028	0.46
16_L	64_R	1.027	0.46
43_L	53_V	1.026	0.46
3_D	45_S	1.025	0.45
5_Y	77_G	1.023	0.45
38_A	45_S	1.009	0.44

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1sg5A	1	1	100	0.093	Contact Map	0.121
1a9xB	4	0.7143	24.5	0.91	Contact Map	0
1kq1A	12	0.9048	22	0.912	Contact Map	0.208
2kk4A	1	0.7262	17.3	0.916	Contact Map	0.434
3ahuA	3	0.881	16.1	0.917	Contact Map	0.239
3pgwB	2	0.8929	15.5	0.917	Contact Map	0
3sb2A	6	0.9048	14.5	0.918	Contact Map	0.226
1u1sA	6	0.8929	12.2	0.921	Contact Map	0.258
2qtxA	12	0.8214	11.4	0.922	Contact Map	0.176
2ylbA	6	0.8214	11	0.923	Contact Map	0.223

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.9474 seconds.