OPENSEQ.org - YIIR - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YIIR - Uncharacterized protein YiiR

UniProt:	P0AF34	Sequence MTIQQWLFSFKGRIGRRDFWIWIGLWFAGMLVLFSLAGKNLLDIQTAAFCLVCLLWPTAAVTVKRLHDRGRSGAWAFLMIVAWMLLAGNWAILPGVWQWAVGRFVPTLILVMMLIDLGAFVGTQGENKYGKDTQDVKYKADNKSSN	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11875
Length:	146 (140)
Sequences:	233
Seq/Len:	1.66

YIIR
Paralog alert: 0.02 [within 20: 0.01] - ratio of genomes with paralogs
Cluster includes: YHAH YHAI YIIR

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
70_G	123_T	3.09	1.00
10_F	60_A	3.068	1.00
15_G	134_Q	2.936	1.00
6_W	9_S	2.284	1.00
14_I	64_K	2.194	0.99
70_G	129_Y	2.109	0.99
122_G	132_D	1.846	0.97
121_V	134_Q	1.826	0.97
70_G	128_K	1.776	0.96
15_G	121_V	1.768	0.96
127_N	130_G	1.646	0.93
123_T	132_D	1.606	0.92
18_D	64_K	1.569	0.91
6_W	64_K	1.527	0.89
115_I	119_A	1.518	0.89
125_G	132_D	1.477	0.87
64_K	118_G	1.476	0.87
21_I	64_K	1.442	0.85
9_S	64_K	1.435	0.85
69_R	117_L	1.383	0.82
81_V	95_G	1.351	0.80
39_K	44_I	1.312	0.77
19_F	77_F	1.278	0.74
100_A	104_F	1.278	0.74
55_L	131_K	1.271	0.74
112_M	116_D	1.261	0.73
6_W	18_D	1.256	0.72
69_R	122_G	1.252	0.72
20_W	69_R	1.249	0.72
69_R	116_D	1.239	0.71
66_L	73_G	1.226	0.70
10_F	28_A	1.223	0.69
66_L	117_L	1.214	0.69
32_V	105_V	1.208	0.68
14_I	18_D	1.204	0.68
35_S	38_G	1.178	0.65
20_W	117_L	1.176	0.65
19_F	55_L	1.172	0.65
131_K	135_D	1.17	0.65
9_S	118_G	1.167	0.64
17_R	121_V	1.159	0.63
21_I	24_G	1.143	0.62
53_C	74_A	1.143	0.62
24_G	70_G	1.14	0.62
6_W	70_G	1.129	0.60
117_L	124_Q	1.128	0.60
108_L	111_V	1.122	0.60
53_C	56_W	1.117	0.59
100_A	115_I	1.115	0.59
75_W	117_L	1.107	0.58
19_F	119_A	1.104	0.58
7_L	64_K	1.095	0.57
64_K	116_D	1.086	0.56
22_W	115_I	1.083	0.56
27_F	31_L	1.08	0.55
69_R	120_F	1.077	0.55
80_I	117_L	1.077	0.55
21_I	126_E	1.068	0.54
30_M	54_L	1.058	0.53
129_Y	138_Y	1.057	0.53
60_A	128_K	1.049	0.52
49_F	110_L	1.048	0.52
128_K	132_D	1.042	0.51
10_F	57_P	1.037	0.51
75_W	120_F	1.035	0.51
67_H	73_G	1.022	0.49
11_K	121_V	1.018	0.49
66_L	76_A	1.017	0.49
54_L	59_A	1.015	0.48
64_K	69_R	1.013	0.48
14_I	22_W	1.012	0.48
18_D	22_W	1.011	0.48
66_L	75_W	1.008	0.48
96_V	104_F	1	0.47

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
3giaA	1	0.9521	12.8	0.939	Contact Map	0.059
2nwlA	3	0.8014	12.5	0.939	Contact Map	0.072
1pw4A	1	0.9658	3.8	0.952	Contact Map	0.061
3dh4A	4	0.9178	3.5	0.953	Contact Map	0.041
1irqA	2	0.1918	3.3	0.953	Contact Map
2kluA	1	0.3973	3	0.954	Contact Map	0.156
3arcI	2	0.2534	2.4	0.956	Contact Map	0.384
2m8rA	1	0.2808	2.4	0.957	Contact Map	0.306
3hd7B	2	0.2808	2.4	0.957	Contact Map	0.498
4hg6A	1	0.9384	2	0.958	Contact Map	0.083

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.8397 seconds.