OPENSEQ.org - BCP - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

BCP - Putative peroxiredoxin bcp

UniProt:	P0AE52	Sequence MNPLKAGDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGISTDKPEKLSRFAEKELLNFTLLSDEDHQVCEQFGVWGEKSFMGKTYDGIHRISFLIDADGKIEHVFDDFKTSNHHDVVLNWLKEHA	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10108
Length:	156 (152)
Sequences:	10066
Seq/Len:	66.22

BCP
Paralog alert: 0.88 [within 20: 0.10] - ratio of genomes with paralogs
Cluster includes: AHPC BCP DSBE TPX

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
32_R	128_A	3.716	1.00
14_S	22_Q	2.952	1.00
10_A	103_F	2.742	1.00
31_Q	66_D	2.738	1.00
54_R	88_N	2.729	1.00
41_A	78_L	2.721	1.00
17_D	21_E	2.645	1.00
63_A	153_K	2.639	1.00
127_D	131_K	2.439	1.00
14_S	24_N	2.401	1.00
127_D	133_E	2.384	1.00
9_I	131_K	2.296	1.00
16_P	22_Q	2.208	1.00
57_M	61_K	2.003	1.00
24_N	27_D	1.96	1.00
5_K	8_D	1.941	1.00
12_K	26_T	1.904	1.00
98_Q	102_Q	1.83	1.00
12_K	24_N	1.817	1.00
56_N	59_E	1.77	1.00
126_I	132_I	1.722	1.00
108_E	115_T	1.703	1.00
15_L	92_L	1.695	1.00
33_V	66_D	1.637	1.00
23_V	28_F	1.589	1.00
110_S	115_T	1.564	1.00
75_P	79_S	1.528	1.00
18_Q	82_A	1.519	1.00
34_L	125_L	1.497	1.00
57_M	88_N	1.485	1.00
17_D	23_V	1.482	1.00
146_D	150_N	1.428	1.00
50_A	87_L	1.42	1.00
58_D	61_K	1.308	0.99
65_V	152_L	1.304	0.99
69_G	89_F	1.296	0.99
134_H	151_W	1.265	0.99
15_L	99_V	1.264	0.99
33_V	130_G	1.26	0.99
79_S	83_E	1.253	0.99
33_V	68_L	1.25	0.99
69_G	91_L	1.248	0.99
26_T	29_Q	1.243	0.98
28_F	33_V	1.233	0.98
52_G	56_N	1.228	0.98
61_K	66_D	1.212	0.98
28_F	68_L	1.207	0.98
56_N	146_D	1.206	0.98
72_T	100_C	1.206	0.98
52_G	55_D	1.202	0.98
107_G	120_H	1.199	0.98
12_K	25_L	1.197	0.98
29_Q	33_V	1.181	0.98
37_F	70_I	1.179	0.98
59_E	62_K	1.173	0.98
36_Y	123_S	1.171	0.98
16_P	75_P	1.162	0.97
42_M	80_R	1.139	0.97
54_R	58_D	1.135	0.97
100_C	119_I	1.122	0.97
76_E	80_R	1.117	0.96
47_T	85_E	1.117	0.96
72_T	97_H	1.109	0.96
17_D	90_T	1.092	0.96
58_D	88_N	1.084	0.96
17_D	92_L	1.075	0.95
80_R	83_E	1.063	0.95
33_V	126_I	1.062	0.95
74_K	77_K	1.06	0.95
32_R	125_L	1.054	0.95
56_N	145_H	1.051	0.94
49_Q	123_S	1.047	0.94
51_C	55_D	1.044	0.94
54_R	89_F	1.042	0.94
32_R	65_V	1.04	0.94
59_E	146_D	1.04	0.94
10_A	126_I	1.036	0.94
37_F	103_F	1.033	0.94
71_S	78_L	1.022	0.93
53_L	67_V	1.021	0.93
36_Y	49_Q	1.019	0.93
99_V	103_F	1.016	0.93
136_F	151_W	1.006	0.93
124_F	132_I	1.001	0.92

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1prxA	2	0.9936	100	0.206	Contact Map	0.697
2v2gA	4	0.9872	100	0.209	Contact Map	0.749
4h86A	1	0.9423	100	0.218	Contact Map	0.648
4gqcA	4	0.9872	100	0.22	Contact Map	0.871
2c0dA	2	0.9551	100	0.222	Contact Map	0.823
1xccA	4	0.9872	100	0.228	Contact Map	0.808
3ixrA	1	1	100	0.229	Contact Map	0.681
1xvwA	2	0.9615	100	0.233	Contact Map	0.778
1xiyA	2	0.9679	100	0.235	Contact Map	0.633
3tjjA	5	0.9615	100	0.235	Contact Map	0.825

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.5714 seconds.