OPENSEQ.org - YHFA - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YHFA - Protein YhfA

UniProt:	P0ADX1	Sequence MQARVKWVEGLTFLGESASGHQILMDGNSGDKAPSPMEMVLMAAGGCSAIDVVSILQKGRQDVVDCEVKLTSERREEAPRLFTHINLHFIVTGRDLKDAAVARAVDLSAEKYCSVALMLEKAVNITHSYEVVAA	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11182
Length:	134 (134)
Sequences:	522
Seq/Len:	3.90

YHFA
Paralog alert: 0.02 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
84_H	124_N	3.371	1.00
86_N	126_T	2.809	1.00
73_E	84_H	2.413	1.00
81_L	118_M	2.35	1.00
98_D	102_A	2.319	1.00
15_G	42_M	2.222	1.00
2_Q	71_T	2.194	1.00
45_G	70_L	2.175	1.00
75_R	83_T	2.172	1.00
59_G	100_A	2.012	1.00
102_A	106_D	1.951	1.00
43_A	115_V	1.939	1.00
37_M	74_R	1.656	0.99
23_I	39_M	1.628	0.99
61_Q	97_K	1.619	0.99
1_M	82_F	1.61	0.99
90_I	130_E	1.598	0.98
86_N	128_S	1.586	0.98
88_H	128_S	1.55	0.98
13_F	53_V	1.539	0.98
105_V	129_Y	1.517	0.98
30_G	35_S	1.502	0.97
74_R	114_S	1.499	0.97
58_K	107_L	1.496	0.97
25_M	46_G	1.462	0.97
49_A	68_V	1.461	0.97
64_V	134_A	1.438	0.96
17_S	42_M	1.436	0.96
2_Q	69_K	1.417	0.96
13_F	49_A	1.408	0.96
64_V	92_T	1.386	0.95
95_D	133_A	1.377	0.95
77_E	80_R	1.374	0.95
75_R	81_L	1.363	0.95
73_E	124_N	1.354	0.95
56_L	101_V	1.344	0.94
85_I	119_L	1.331	0.94
37_M	114_S	1.308	0.93
50_I	115_V	1.272	0.92
88_H	130_E	1.25	0.91
8_V	14_L	1.228	0.90
55_I	104_A	1.226	0.90
40_V	115_V	1.222	0.90
92_T	134_A	1.199	0.88
31_D	35_S	1.196	0.88
14_L	22_Q	1.191	0.88
17_S	21_H	1.181	0.87
5_V	45_G	1.155	0.86
60_R	107_L	1.147	0.85
117_L	120_E	1.147	0.85
68_V	87_L	1.137	0.85
34_P	42_M	1.136	0.84
106_D	110_E	1.132	0.84
6_K	67_E	1.13	0.84
102_A	129_Y	1.113	0.83
105_V	122_A	1.104	0.82
118_M	121_K	1.094	0.81
25_M	39_M	1.077	0.80
12_T	24_L	1.076	0.80
51_D	108_S	1.075	0.80
109_A	116_A	1.059	0.78
48_S	87_L	1.055	0.78
48_S	89_F	1.051	0.78
4_R	67_E	1.041	0.77
70_L	87_L	1.04	0.76
85_I	125_I	1.031	0.76
61_Q	100_A	1.027	0.75
27_G	35_S	1.026	0.75
44_A	119_L	1.025	0.75
69_K	90_I	1.015	0.74
94_R	133_A	1.011	0.74
3_A	17_S	1.005	0.73
62_D	95_D	1.003	0.73

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1ml8A	1	0.9851	100	0.386	Contact Map	0.588
1vlaA	4	0.9925	100	0.412	Contact Map	0.737
2onfA	2	0.9701	99.9	0.459	Contact Map	0.679
2e8eA	1	0.9552	99.9	0.466	Contact Map	0.649
2pn2A	1	0.9701	99.9	0.473	Contact Map	0.484
2oplA	1	0.9701	99.9	0.482	Contact Map	0.316
3cjeA	1	0.9851	99.9	0.486	Contact Map	0.427
1ukkA	2	0.9776	99.9	0.487	Contact Map	0.649
1nyeA	6	0.9701	99.9	0.495	Contact Map	0.611
1lqlA	10	0.9776	99.9	0.498	Contact Map	0.607

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.3492 seconds.