OPENSEQ.org - YJIX - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YJIX - Uncharacterized protein YjiX

UniProt:	P0ADC8	Sequence MFGNLGQAKKYLGQAAKMLIGIPDYDNYVEHMKTNHPDKPYMSYEEFFRERQNARYGGDGKGGMRCC	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12585
Length:	67 (65)
Sequences:	163
Seq/Len:	2.51

YJIX
Paralog alert: 0.54 [within 20: 0.00] - ratio of genomes with paralogs
Cluster includes: YBDD YJIX

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
43_S	46_E	3.296	1.00
5_L	8_A	1.905	0.99
17_K	20_I	1.85	0.99
26_D	63_G	1.832	0.99
48_F	52_Q	1.711	0.98
11_Y	14_Q	1.62	0.96
15_A	18_M	1.551	0.95
30_E	34_T	1.528	0.95
30_E	33_K	1.494	0.94
42_M	51_R	1.434	0.92
10_K	16_A	1.41	0.91
16_A	63_G	1.331	0.87
49_R	55_R	1.318	0.87
33_K	39_K	1.284	0.85
39_K	65_R	1.226	0.81
4_N	7_Q	1.222	0.81
18_M	50_E	1.213	0.80
22_I	33_K	1.21	0.80
23_P	51_R	1.199	0.79
23_P	56_Y	1.185	0.78
3_G	6_G	1.177	0.77
31_H	36_H	1.14	0.74
51_R	57_G	1.094	0.69
31_H	47_F	1.082	0.68
35_N	41_Y	1.075	0.67
19_L	30_E	1.057	0.66
33_K	64_M	1.03	0.63
26_D	39_K	1.029	0.62
19_L	42_M	1.026	0.62
1_M	29_V	1.013	0.61
19_L	65_R	1.007	0.60

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
2im9A	1	0.8955	10.6	0.918	Contact Map	0.238
3epoA	2	0.9403	5.9	0.926	Contact Map	0.333
2iw0A	1	0.5224	5.6	0.927	Contact Map	0.073
1t98A	2	0.4776	5.1	0.929	Contact Map	0.818
3msvA	2	0.5075	4.9	0.929	Contact Map	0.5
3qtmA	2	0.5075	4.5	0.93	Contact Map	0.531
3tg2A	1	0.5373	4.3	0.931	Contact Map	0.688
4h4jA	1	0.8358	3.7	0.933	Contact Map	0.302
3i2wA	2	0.7015	3.6	0.933	Contact Map	0.085
1tq5A	1	0.5075	3.2	0.935	Contact Map	0

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.6847 seconds.