OPENSEQ.org - OSMB - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

OSMB - Osmotically-inducible lipoprotein B

UniProt:	P0ADA7	Sequence MFVTSKKMTAAVLAITLAMSLSACSNWSKRDRNTAIGAGAGALGGAVLTDGSTLGTLGGAAVGGVIGHQVGK	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10679
Length:	72 (72)
Sequences:	163
Seq/Len:	2.26

OSMB
Paralog alert: 0.07 [within 20: 0.01] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
20_S	23_A	3.293	1.00
49_T	55_G	1.77	0.98
34_T	69_Q	1.754	0.98
31_D	42_A	1.693	0.97
50_D	54_L	1.677	0.97
36_I	40_A	1.489	0.92
36_I	39_G	1.486	0.92
62_V	68_H	1.425	0.90
32_R	57_L	1.418	0.90
23_A	43_L	1.408	0.89
58_G	66_I	1.344	0.86
46_A	62_V	1.326	0.85
43_L	46_A	1.307	0.84
30_R	46_A	1.291	0.83
16_T	26_N	1.291	0.83
36_I	52_S	1.264	0.81
11_A	21_L	1.257	0.81
39_G	42_A	1.239	0.79
39_G	47_V	1.237	0.79
30_R	69_Q	1.219	0.78
14_A	23_A	1.218	0.78
31_D	48_L	1.192	0.76
17_L	27_W	1.174	0.74
19_M	40_A	1.172	0.74
21_L	43_L	1.147	0.71
47_V	52_S	1.147	0.71
52_S	55_G	1.144	0.71
42_A	48_L	1.112	0.68
18_A	53_T	1.107	0.68
37_G	56_T	1.09	0.66
10_A	22_S	1.07	0.64
40_A	44_G	1.061	0.63
7_K	12_V	1.047	0.61
9_T	25_S	1.03	0.59
46_A	71_G	1.027	0.59
7_K	28_S	1.015	0.58
29_K	52_S	1.013	0.57

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
3pmqA	1	0.9167	37.4	0.855	Contact Map	0
4fajA	1	0.9306	31.5	0.861	Contact Map	0.055
4kysA	2	0.7917	29.3	0.863	Contact Map	0
3ldtA	1	0.3611	27.9	0.865	Contact Map
4jwoA	1	0.8889	24.9	0.868	Contact Map	0
3ombA	1	0.8333	24.3	0.869	Contact Map	0.097
3vxbA	1	0.7778	24.3	0.869	Contact Map	0
4edpA	2	0.7222	19.5	0.874	Contact Map	0
2vozA	2	0.7083	18.4	0.876	Contact Map	0
3ucpA	1	0.8889	17.2	0.877	Contact Map	0.055

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.2284 seconds.