OPENSEQ.org - HNS - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

HNS - DNA-binding protein H-NS

UniProt:	P0ACF8	Sequence MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10457
Length:	137 (134)
Sequences:	267
Seq/Len:	1.99

HNS
Paralog alert: 0.64 [within 20: 0.01] - ratio of genomes with paralogs
Cluster includes: HNS STPA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
120_K	125_E	2.301	1.00
115_T	123_M	2.222	1.00
98_S	106_T	2.181	1.00
121_K	126_Q	2.102	0.99
61_Y	64_M	1.965	0.99
9_N	13_T	1.931	0.99
9_N	25_T	1.798	0.97
27_E	41_R	1.714	0.96
93_R	112_Q	1.697	0.96
38_N	41_R	1.691	0.96
131_D	134_L	1.672	0.96
10_N	15_R	1.592	0.94
99_Y	119_I	1.589	0.94
4_A	17_Q	1.57	0.93
119_I	133_F	1.562	0.93
30_L	37_V	1.492	0.91
52_E	56_R	1.486	0.91
56_R	64_M	1.474	0.90
63_E	67_A	1.442	0.89
56_R	60_Q	1.441	0.89
30_L	34_E	1.441	0.89
119_I	129_S	1.438	0.88
49_A	58_L	1.425	0.88
59_Q	62_R	1.424	0.88
120_K	123_M	1.401	0.87
119_I	122_A	1.386	0.86
119_I	130_L	1.386	0.86
13_T	25_T	1.379	0.86
128_K	132_D	1.358	0.84
114_R	119_I	1.35	0.84
18_A	42_E	1.346	0.84
4_A	7_I	1.314	0.82
88_A	131_D	1.31	0.81
90_R	112_Q	1.302	0.81
130_L	133_F	1.28	0.79
11_I	15_R	1.279	0.79
2_S	33_L	1.273	0.79
13_T	19_R	1.262	0.78
60_Q	64_M	1.248	0.77
41_R	103_N	1.184	0.71
10_N	13_T	1.18	0.71
44_E	48_A	1.165	0.69
34_E	38_N	1.161	0.69
99_Y	107_K	1.161	0.69
20_E	28_E	1.157	0.69
7_I	13_T	1.155	0.69
72_P	76_L	1.142	0.67
51_V	85_G	1.135	0.67
117_A	120_K	1.13	0.66
18_A	36_V	1.123	0.65
9_N	18_A	1.121	0.65
27_E	30_L	1.116	0.65
10_N	19_R	1.091	0.62
21_C	29_M	1.085	0.61
98_S	108_T	1.067	0.60
32_K	94_P	1.052	0.58
57_K	131_D	1.03	0.55
28_E	57_K	1.026	0.55
72_P	78_S	1.024	0.55
2_S	105_E	1.024	0.55
27_E	128_K	1.023	0.55
77_N	80_A	1.023	0.55
18_A	33_L	1.015	0.54
17_Q	62_R	1.012	0.53
40_R	94_P	1.009	0.53
5_L	65_L	1.003	0.52
21_C	25_T	1.001	0.52

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3nr7A	2	0.6058	99.8	0.534	Contact Map	0.508
2l93A	1	0.3358	99.7	0.583	Contact Map	0.683
1hnrA	1	0.3358	99.7	0.595	Contact Map	0.488
2l92A	1	0.2701	99.4	0.678	Contact Map	0.602
4icgB	2	0.3358	99.3	0.687	Contact Map	0.556
2jr1A	1	0.5036	99.3	0.693	Contact Map	0.158
2levA	1	0.3869	99.3	0.694	Contact Map	0.672
1ov9A	2	0.365	99.3	0.694	Contact Map	0.603
1x57A	1	0.6131	41.4	0.922	Contact Map	0.351
3bpjA	4	0.3285	32.5	0.926	Contact Map	0.729

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 1.6089 seconds.