OPENSEQ.org - FLIL - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

FLIL - Flagellar protein FliL

UniProt:	P0ABX8	Sequence MTDYAISKKSKRSLWIPILVFITLAACASAGYSYWHSHQVAADDKAQQRVVPSPVFYALDTFTVNLGDADRVLYIGITLRLKDEATRSRLSEYLPEVRSRLLLLFSRQDAAVLATEEGKKNLIAEIKTTLSTPLVAGQPKQDVTDVLYTAFILR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10322
Length:	154 (148)
Sequences:	432
Seq/Len:	2.92

FLIL
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
15_W	19_L	4.189	1.00
29_S	33_S	2.253	1.00
31_G	35_W	2.201	1.00
16_I	20_V	2.183	1.00
88_S	91_S	2.164	1.00
57_Y	81_L	2.08	1.00
108_Q	125_E	1.896	0.99
73_L	105_F	1.756	0.99
11_K	14_L	1.753	0.99
33_S	37_S	1.73	0.98
25_A	29_S	1.686	0.98
106_S	119_K	1.666	0.98
23_T	26_A	1.599	0.97
74_Y	150_A	1.596	0.97
108_Q	112_V	1.584	0.97
32_Y	36_H	1.584	0.97
10_S	15_W	1.534	0.96
19_L	22_I	1.495	0.95
109_D	112_V	1.491	0.95
64_V	73_L	1.479	0.95
18_I	21_F	1.437	0.94
20_V	23_T	1.414	0.93
64_V	119_K	1.405	0.93
80_R	96_E	1.355	0.91
72_V	138_Q	1.315	0.89
104_L	108_Q	1.299	0.89
129_T	132_T	1.289	0.88
84_E	88_S	1.283	0.88
17_P	21_F	1.256	0.86
60_D	98_R	1.237	0.85
90_L	136_A	1.231	0.85
99_S	147_L	1.223	0.84
106_S	109_D	1.218	0.84
32_Y	35_W	1.208	0.83
100_R	133_P	1.206	0.83
70_D	113_L	1.195	0.82
84_E	87_R	1.173	0.81
56_F	126_I	1.172	0.80
13_S	24_L	1.163	0.80
66_L	99_S	1.159	0.79
32_Y	78_T	1.151	0.79
44_D	47_Q	1.149	0.79
77_I	128_T	1.134	0.77
56_F	147_L	1.132	0.77
15_W	22_I	1.111	0.75
57_Y	91_S	1.106	0.75
22_I	26_A	1.102	0.74
96_E	147_L	1.092	0.74
100_R	123_I	1.086	0.73
64_V	98_R	1.086	0.73
104_L	122_L	1.08	0.72
13_S	18_I	1.069	0.71
74_Y	152_I	1.063	0.71
79_L	146_V	1.062	0.71
131_S	141_Q	1.057	0.70
20_V	27_C	1.056	0.70
16_I	24_L	1.055	0.70
29_S	32_Y	1.043	0.69
101_L	126_I	1.041	0.68
10_S	13_S	1.027	0.67
105_F	126_I	1.024	0.67
60_D	64_V	1.024	0.67
72_V	150_A	1.022	0.66
59_L	98_R	1.02	0.66
91_S	130_L	1.007	0.65
99_S	103_L	1.005	0.64

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
3zg1A	4	0.7727	33.3	0.923	Contact Map	0.219
3ne5B	2	0.8701	25	0.927	Contact Map	0
2m8rA	1	0.2403	23.7	0.928	Contact Map	0.589
3hd7B	2	0.2403	23.7	0.928	Contact Map	0.611
3owqA	4	0.9286	18.1	0.932	Contact Map	0.118
3bk6A	3	0.6818	17.6	0.932	Contact Map	0.306
3k49A	3	0.3247	13.2	0.936	Contact Map	0.181
2rpbA	1	0.7078	12.8	0.936	Contact Map	0.247
2ongA	2	0.5974	12.4	0.937	Contact Map	0.232
4fvgA	1	0.7078	11.5	0.938	Contact Map	0.319

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.3357 seconds.