OPENSEQ.org - YCGL - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YCGL - Protein YcgL

UniProt:	P0AB43	Sequence MFCVIYRSSKRDQTYLYVEKKDDFSRVPEELMKGFGQPQLAMILPLDGRKKLVNADIEKVKQALTEQGYYLQLPPPPEDLLKQHLSVMGQKTDDTNK	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13893
Length:	97 (92)
Sequences:	235
Seq/Len:	2.55

YCGL
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
55_A	70_Y	3.39	1.00
35_F	38_P	2.536	1.00
7_R	41_A	2.304	1.00
5_I	17_Y	1.994	0.99
2_F	45_P	1.862	0.99
62_Q	66_E	1.833	0.99
40_L	43_I	1.727	0.98
14_T	73_L	1.672	0.97
9_S	32_M	1.627	0.97
64_L	69_Y	1.601	0.96
13_Q	54_N	1.539	0.95
2_F	20_K	1.534	0.95
79_D	83_Q	1.532	0.95
46_L	78_E	1.517	0.95
63_A	70_Y	1.47	0.93
58_E	61_K	1.456	0.93
85_L	89_G	1.443	0.92
82_K	85_L	1.436	0.92
3_C	27_V	1.409	0.91
19_E	26_R	1.4	0.91
11_R	30_E	1.393	0.91
14_T	24_F	1.357	0.89
86_S	92_T	1.223	0.81
49_R	61_K	1.221	0.81
30_E	69_Y	1.211	0.80
55_A	60_V	1.115	0.72
30_E	62_Q	1.086	0.69
29_E	33_K	1.082	0.69
78_E	83_Q	1.081	0.69
21_K	24_F	1.075	0.68
24_F	40_L	1.071	0.67
17_Y	69_Y	1.07	0.67
57_I	64_L	1.064	0.67
22_D	64_L	1.06	0.66
16_L	27_V	1.052	0.65
5_I	53_V	1.051	0.65
87_V	90_Q	1.042	0.64
19_E	64_L	1.042	0.64
46_L	67_Q	1.042	0.64
18_V	55_A	1.035	0.64
10_K	21_K	1.033	0.63
88_M	91_K	1.024	0.62
6_Y	22_D	1.016	0.61
14_T	23_D	1.015	0.61
87_V	91_K	1.013	0.61

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2h7aA	1	1	100	0.05	Contact Map	0.415
1k7hA	2	0.9588	35.6	0.912	Contact Map	0.192
2qmhA	12	0.9485	30.9	0.915	Contact Map	0.135
4f7zA	1	0.9691	7.6	0.936	Contact Map	0.04
3cf6E	1	0.9691	6.5	0.938	Contact Map	0.033
1zedA	1	0.9381	6.1	0.938	Contact Map	0.223
4kn7A	4	0.8454	5.9	0.939	Contact Map	0.099
1knxA	6	0.9278	4.7	0.942	Contact Map	0.107
1ko7A	2	0.9485	4.4	0.943	Contact Map	0.123
3u65B	2	0.9485	4.3	0.943	Contact Map	0.159

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.9721 seconds.