OPENSEQ.org - YAEQ - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YAEQ - Uncharacterized protein YaeQ

UniProt:	P0AA97	Sequence MALKATIYKATVNVADLDRNQFLDASLTLARHPSETQERMMLRLLAWLKYADERLQFTRGLCADDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQAAEVALFTYNSRAAQIWWQQNQSKCVQFANLSVWYLDDEQLAKVSAFADRTMTLQATIQDGVIWLSDDKNNLEVNLTAWQQPS	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13223
Length:	181 (181)
Sequences:	299
Seq/Len:	1.65

YAEQ
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
21_Q	25_A	3.163	1.00
50_Y	105_F	3.025	1.00
154_A	163_L	2.314	1.00
15_A	24_D	2.269	0.99
73_N	77_G	2.215	0.99
96_C	129_L	2.169	0.99
52_D	71_L	2.095	0.99
80_L	103_A	1.903	0.98
84_L	126_F	1.796	0.96
21_Q	51_A	1.653	0.93
14_V	25_A	1.653	0.93
12_V	48_L	1.632	0.93
20_N	59_R	1.601	0.92
66_E	70_W	1.591	0.91
8_Y	37_Q	1.572	0.91
50_Y	103_A	1.509	0.88
11_T	151_T	1.445	0.85
65_D	145_F	1.436	0.85
92_I	104_L	1.409	0.83
14_V	82_I	1.386	0.82
31_R	37_Q	1.381	0.82
86_L	139_L	1.381	0.82
49_K	161_I	1.366	0.81
155_T	162_W	1.361	0.80
29_L	44_L	1.354	0.80
41_M	150_M	1.344	0.79
147_D	165_D	1.337	0.79
71_L	79_D	1.319	0.77
105_F	132_W	1.31	0.77
59_R	72_R	1.309	0.76
42_L	84_L	1.308	0.76
83_E	92_I	1.301	0.76
14_V	21_Q	1.296	0.75
41_M	145_F	1.285	0.75
75_H	84_L	1.285	0.75
60_G	68_E	1.282	0.74
95_A	102_V	1.274	0.74
22_F	69_A	1.265	0.73
119_N	123_C	1.227	0.70
142_V	155_T	1.221	0.69
67_P	72_R	1.218	0.69
69_A	105_F	1.218	0.69
153_Q	163_L	1.215	0.69
15_A	74_D	1.211	0.68
53_E	149_T	1.209	0.68
160_V	171_E	1.206	0.68
165_D	168_N	1.205	0.68
8_Y	31_R	1.181	0.65
92_I	159_G	1.177	0.65
123_C	129_L	1.162	0.64
21_Q	109_S	1.158	0.63
86_L	106_T	1.153	0.63
21_Q	47_W	1.143	0.62
67_P	91_R	1.132	0.61
28_T	39_R	1.128	0.60
42_L	86_L	1.124	0.60
48_L	163_L	1.115	0.59
4_K	153_Q	1.114	0.59
49_K	174_L	1.104	0.58
77_G	84_L	1.098	0.57
74_D	98_Q	1.094	0.57
134_L	156_I	1.093	0.57
16_D	19_R	1.085	0.56
93_K	126_F	1.082	0.55
72_R	78_I	1.076	0.55
67_P	83_E	1.075	0.55
133_Y	177_W	1.071	0.54
41_M	152_L	1.07	0.54
4_K	162_W	1.068	0.54
8_Y	40_M	1.067	0.54
134_L	139_L	1.066	0.54
38_E	109_S	1.066	0.54
162_W	171_E	1.053	0.52
90_R	162_W	1.048	0.52
80_L	101_E	1.047	0.52
63_A	93_K	1.045	0.51
4_K	17_L	1.043	0.51
93_K	97_T	1.042	0.51
84_L	87_P	1.038	0.51
105_F	143_S	1.033	0.50
48_L	98_Q	1.03	0.50
104_L	151_T	1.028	0.50
40_M	143_S	1.019	0.49
31_R	38_E	1.015	0.48
132_W	154_A	1.01	0.48
112_A	177_W	1.002	0.47
127_A	144_A	1.001	0.47

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2g3wA	2	0.9834	100	0.013	Contact Map	0.563
3c0uA	2	0.989	100	0.015	Contact Map	0.498
2ot9A	1	0.9834	100	0.029	Contact Map	0.49
3gb3A	2	0.3149	40.7	0.957	Contact Map	0.128
3wckA	8	0.2762	10.5	0.967	Contact Map	0.091
3be3A	2	0.3812	11.1	0.967	Contact Map	0.233
2xn4A	2	0.6464	9.6	0.968	Contact Map	0.109
2vpjA	1	0.6519	6.8	0.97	Contact Map	0.167
3u8pA	3	0.2928	6.5	0.97	Contact Map	0.085
3t3lA	1	0.3094	6.5	0.97	Contact Map	0.352

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 1.3563 seconds.