OPENSEQ.org - FTNB - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

FTNB - Ferritin-like protein 2

UniProt:	P0A9A2	Sequence MATAGMLLKLNSQMNREFYASNLYLHLSNWCSEQSLNGTATFLRAQAQSNVTQMMRMFNFMKSVGATPIVKAIDVPGEKLNSLEELFQKTMEEYEQRSSTLAQLADEAKELNDDSTVNFLRDLEKEQQHDGLLLQTILDEVRSAKLAGMCPVQTDQHVLNVVSHQLH	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13175
Length:	167 (162)
Sequences:	1273
Seq/Len:	7.86

FTNB
Paralog alert: 0.39 [within 20: 0.18] - ratio of genomes with paralogs
Cluster includes: FTNA FTNB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
88_Q	142_R	3.201	1.00
84_E	138_L	2.705	1.00
16_R	100_T	2.48	1.00
39_T	83_L	2.346	1.00
106_D	112_N	2.261	1.00
14_M	61_M	2.05	1.00
9_K	107_E	1.969	1.00
61_M	66_A	1.94	1.00
81_N	85_E	1.933	1.00
3_T	111_L	1.921	1.00
31_C	86_L	1.893	1.00
5_G	111_L	1.872	1.00
7_L	66_A	1.846	1.00
109_K	117_V	1.718	1.00
99_S	103_Q	1.712	1.00
82_S	85_E	1.693	1.00
118_N	125_K	1.655	1.00
10_L	116_T	1.622	1.00
91_M	95_E	1.575	1.00
44_R	59_N	1.561	1.00
10_L	57_M	1.558	1.00
43_L	90_T	1.536	1.00
31_C	43_L	1.524	1.00
63_S	132_L	1.514	1.00
106_D	110_E	1.504	1.00
87_F	141_V	1.491	0.99
77_G	89_K	1.487	0.99
84_E	142_R	1.479	0.99
4_A	8_L	1.474	0.99
96_Q	100_T	1.47	0.99
22_N	70_V	1.469	0.99
10_L	60_F	1.452	0.99
10_L	61_M	1.435	0.99
89_K	92_E	1.425	0.99
64_V	113_D	1.396	0.99
132_L	136_T	1.375	0.99
30_W	34_Q	1.362	0.99
87_F	137_I	1.33	0.99
90_T	134_L	1.322	0.98
41_T	45_A	1.315	0.98
80_L	89_K	1.31	0.98
145_K	148_G	1.29	0.98
29_N	58_F	1.29	0.98
35_S	139_D	1.284	0.98
45_A	133_L	1.279	0.98
8_L	12_S	1.272	0.98
37_N	140_E	1.254	0.98
7_L	61_M	1.251	0.98
32_S	40_A	1.233	0.97
50_N	53_Q	1.228	0.97
125_K	129_H	1.223	0.97
96_Q	99_S	1.194	0.96
31_C	83_L	1.19	0.96
27_L	80_L	1.185	0.96
105_A	121_R	1.175	0.96
121_R	125_K	1.167	0.96
17_E	53_Q	1.151	0.95
9_K	104_L	1.15	0.95
118_N	121_R	1.146	0.95
46_Q	133_L	1.142	0.95
32_S	37_N	1.141	0.95
17_E	127_Q	1.14	0.95
52_T	56_R	1.134	0.95
140_E	157_H	1.133	0.95
127_Q	130_D	1.13	0.95
60_F	116_T	1.12	0.94
106_D	114_D	1.107	0.94
24_Y	94_Y	1.105	0.94
152_V	156_Q	1.1	0.94
102_A	114_D	1.099	0.94
105_A	124_E	1.086	0.93
94_Y	127_Q	1.084	0.93
21_S	47_A	1.082	0.93
69_I	75_V	1.075	0.93
84_E	88_Q	1.074	0.93
71_K	75_V	1.052	0.92
88_Q	92_E	1.05	0.92
50_N	130_D	1.045	0.91
65_G	135_Q	1.044	0.91
77_G	85_E	1.023	0.90
75_V	78_E	1.02	0.90
26_H	80_L	1.015	0.90
115_S	124_E	1.014	0.90
25_L	28_S	1.01	0.89
39_T	87_F	1.01	0.89
49_S	53_Q	1.007	0.89
30_W	86_L	1.003	0.89
135_Q	139_D	1.002	0.89

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1z6oA	12	0.9641	100	0.249	Contact Map	0.546
1vlgA	8	0.9701	100	0.278	Contact Map	0.872
1z6oM	12	0.976	100	0.281	Contact Map	0.689
3a68A	24	0.988	100	0.292	Contact Map	0.771
3vnxA	1	0.9701	100	0.299	Contact Map	0.622
1s3qA	12	1	100	0.316	Contact Map	0.899
1eumA	6	0.988	100	0.316	Contact Map	0.823
3kxuA	1	0.994	100	0.324	Contact Map	0.583
3bvfA	6	1	100	0.327	Contact Map	0.819
1krqA	1	1	100	0.328	Contact Map	0.646

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.5958 seconds.