OPENSEQ.org - RRAA - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

RRAA - Regulator of ribonuclease activity A

UniProt:	P0A8R0	Sequence MKYDTSELCDIYQEDVNVVEPLFSNFGGRASFGGQIITVKCFEDNGLLYDLLEQNGRGRVLVVDGGGSVRRALVDAELARLAVQNEWEGLVIYGAVRQVDDLEELDIGIQAMAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGIILSEDPLDIE	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11879
Length:	161 (158)
Sequences:	1557
Seq/Len:	9.85

RRAA
Paralog alert: 0.32 [within 20: 0.03] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
76_A	101_D	3.114	1.00
37_I	128_D	2.875	1.00
55_N	87_W	2.752	1.00
100_D	148_N	2.719	1.00
65_G	73_L	2.599	1.00
128_D	140_S	2.37	1.00
74_V	79_A	2.348	1.00
56_G	59_R	2.131	1.00
144_L	153_L	2.096	1.00
29_R	148_N	2.083	1.00
126_E	129_V	2.057	1.00
36_I	144_L	1.938	1.00
36_I	138_F	1.933	1.00
40_K	64_D	1.892	1.00
110_Q	146_A	1.883	1.00
130_R	139_F	1.862	1.00
32_F	89_G	1.85	1.00
96_V	102_L	1.832	1.00
90_L	107_I	1.821	1.00
83_V	105_L	1.784	1.00
79_A	102_L	1.739	1.00
95_A	113_A	1.708	1.00
103_E	148_N	1.699	1.00
37_I	59_R	1.674	1.00
139_F	157_P	1.668	1.00
40_K	126_E	1.615	1.00
60_V	88_E	1.592	1.00
74_V	90_L	1.584	1.00
36_I	142_D	1.556	1.00
19_V	133_F	1.51	1.00
29_R	106_D	1.474	1.00
91_V	144_L	1.469	1.00
57_R	86_E	1.46	1.00
19_V	138_F	1.438	1.00
45_N	121_G	1.428	1.00
102_L	109_I	1.419	1.00
35_Q	59_R	1.402	0.99
25_N	110_Q	1.4	0.99
73_L	94_G	1.375	0.99
80_R	84_Q	1.369	0.99
62_V	144_L	1.355	0.99
6_S	149_T	1.322	0.99
8_L	145_Y	1.301	0.99
32_F	60_V	1.296	0.99
52_L	82_A	1.294	0.99
35_Q	58_G	1.29	0.99
35_Q	143_H	1.271	0.99
38_T	128_D	1.264	0.99
145_Y	154_S	1.262	0.99
32_F	110_Q	1.259	0.99
55_N	61_L	1.258	0.99
26_F	111_A	1.253	0.99
99_V	149_T	1.253	0.99
61_L	87_W	1.249	0.98
99_V	114_A	1.24	0.98
100_D	149_T	1.232	0.98
55_N	82_A	1.22	0.98
32_F	146_A	1.207	0.98
71_R	119_A	1.206	0.98
54_Q	127_S	1.202	0.98
77_E	81_L	1.201	0.98
129_V	140_S	1.199	0.98
146_A	151_I	1.189	0.98
83_V	107_I	1.184	0.98
83_V	106_D	1.176	0.98
48_L	63_V	1.171	0.97
133_F	138_F	1.167	0.97
36_I	153_L	1.166	0.97
7_E	10_D	1.158	0.97
28_G	103_E	1.141	0.97
69_V	95_A	1.132	0.97
10_D	97_R	1.129	0.97
91_V	146_A	1.121	0.96
52_L	78_L	1.096	0.96
52_L	61_L	1.068	0.95
41_C	48_L	1.035	0.94
22_L	112_M	1.029	0.93
23_F	133_F	1	0.92

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1vi4A	1	1	100	0.045	Contact Map	0.768
3c8oA	2	1	100	0.051	Contact Map	0.797
3nojA	1	0.9938	100	0.057	Contact Map	0.791
1q5xA	3	1	100	0.059	Contact Map	0.838
1j3lA	6	0.9938	100	0.07	Contact Map	0.909
2pcnA	1	0.9876	100	0.078	Contact Map	0.759
3k4iA	3	0.9938	100	0.08	Contact Map	0.763
1nxjA	3	0.9565	100	0.095	Contact Map	0.772
2c5qA	6	0.9938	100	0.107	Contact Map	0.823
1oaoC	2	0.8323	12.8	0.943	Contact Map	0.07

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.1693 seconds.