OPENSEQ.org - YACG - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YACG - DNA gyrase inhibitor YacG

UniProt:	P0A8H8	Sequence MSETITVNCPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDLSESDDWSEEPKQ	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12314
Length:	65 (63)
Sequences:	341
Seq/Len:	5.41

YACG
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
30_K	33_Q	2.998	1.00
39_E	45_K	2.949	1.00
11_T	35_I	2.207	1.00
33_Q	41_A	1.799	1.00
16_V	22_S	1.732	1.00
6_T	15_T	1.703	1.00
34_L	45_K	1.576	0.99
34_L	37_L	1.572	0.99
19_G	23_P	1.547	0.99
31_R	37_L	1.495	0.99
43_E	46_R	1.461	0.98
15_T	20_E	1.449	0.98
34_L	39_E	1.402	0.98
55_E	61_E	1.345	0.97
7_V	16_V	1.314	0.96
35_I	38_G	1.28	0.96
18_W	34_L	1.235	0.94
50_S	53_L	1.15	0.91
1_M	63_P	1.099	0.88
55_E	59_W	1.094	0.88
22_S	39_E	1.09	0.88
8_N	15_T	1.088	0.88
57_D	60_S	1.087	0.88
7_V	41_A	1.082	0.87
17_V	22_S	1.077	0.87
17_V	21_I	1.046	0.85
18_W	25_R	1.044	0.85
58_D	61_E	1.031	0.84
24_F	44_E	1.029	0.84
58_D	62_E	1.027	0.83
18_W	41_A	1.015	0.82
2_S	5_I	1.006	0.82
1_M	52_D	1.004	0.81
20_E	61_E	1.004	0.81
55_E	60_S	1.001	0.81

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1lv3A	1	1	99.9	0.099	Contact Map	0.369
3i2dA	1	0.7231	55	0.858	Contact Map	0.096
1mtyD	2	1	46.5	0.865	Contact Map	0.341
3u52A	2	0.9538	40.1	0.87	Contact Map	0.556
3ge3A	1	0.9385	32.5	0.877	Contact Map	0.693
2incA	1	0.9692	31.8	0.877	Contact Map	0.694
3vhsA	2	0.4	17.3	0.891	Contact Map	0.4
3vhtB	1	0.5231	12.6	0.898	Contact Map	0.327
4g9pA	1	0.7231	11.4	0.9	Contact Map	0.04
3qwwA	1	0.9231	10.8	0.901	Contact Map	0.727

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 1.3108 seconds.