OPENSEQ.org - DUT - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

DUT - Deoxyuridine 5'-triphosphate nucleotidohydrolase

UniProt:	P06968	Sequence MKKIDVKILDPRVGKEFPLPTYATSGSAGLDLRACLNDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRSGLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDSFTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEGGFGHSGRQ	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10251
Length:	151 (145)
Sequences:	1877
Seq/Len:	12.94

DUT
Paralog alert: 0.04 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
57_H	136_D	3.21	1.00
24_T	27_S	3.151	1.00
39_A	111_Q	3.094	1.00
43_A	107_S	2.749	1.00
79_I	108_F	2.525	1.00
111_Q	114_E	2.493	1.00
27_S	91_D	2.475	1.00
65_A	119_M	2.379	1.00
26_G	90_S	2.34	1.00
8_I	131_L	2.301	1.00
43_A	46_D	2.295	1.00
24_T	91_D	2.294	1.00
29_G	120_I	2.278	1.00
4_I	129_F	2.152	1.00
75_H	99_S	2.066	1.00
5_D	130_N	2.04	1.00
47_T	78_G	2.008	1.00
30_L	129_F	1.971	1.00
46_D	105_Q	1.952	1.00
68_L	87_L	1.928	1.00
51_P	97_M	1.92	1.00
77_H	108_F	1.836	1.00
114_E	150_R	1.827	1.00
58_I	121_F	1.744	1.00
22_Y	30_L	1.73	1.00
42_L	48_T	1.697	1.00
41_E	109_T	1.696	1.00
44_P	107_S	1.64	1.00
22_Y	126_Q	1.619	1.00
98_I	117_A	1.584	1.00
66_M	87_L	1.578	1.00
9_L	55_A	1.57	1.00
34_A	110_I	1.568	1.00
57_H	93_Q	1.56	1.00
41_E	107_S	1.486	1.00
49_L	75_H	1.485	1.00
39_A	112_P	1.461	1.00
66_M	122_V	1.445	1.00
49_L	97_M	1.437	1.00
58_I	65_A	1.383	0.99
68_L	122_V	1.33	0.99
53_G	95_Q	1.322	0.99
32_L	65_A	1.32	0.99
22_Y	127_A	1.305	0.99
3_K	128_E	1.304	0.99
64_A	87_L	1.304	0.99
110_I	116_I	1.303	0.99
12_R	112_P	1.297	0.99
10_D	53_G	1.276	0.99
56_I	65_A	1.271	0.99
67_M	119_M	1.261	0.99
51_P	95_Q	1.256	0.99
39_A	109_T	1.247	0.99
21_T	33_R	1.241	0.98
64_A	68_L	1.237	0.98
5_D	57_H	1.227	0.98
8_I	19_L	1.227	0.98
17_F	112_P	1.217	0.98
23_A	33_R	1.175	0.98
45_G	105_Q	1.154	0.97
18_P	33_R	1.137	0.97
3_K	130_N	1.136	0.97
80_V	101_W	1.118	0.96
68_L	85_V	1.107	0.96
56_I	96_L	1.101	0.96
70_R	115_R	1.075	0.95
7_K	134_D	1.069	0.95
63_L	121_F	1.065	0.95
64_A	122_V	1.06	0.95
80_V	103_R	1.052	0.95
52_T	98_I	1.048	0.94
99_S	145_F	1.042	0.94
36_L	40_V	1.031	0.94
69_P	84_L	1.026	0.94
121_F	127_A	1.012	0.93
65_A	121_F	1.006	0.93
67_M	117_A	1.006	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3hzaA	1	0.9536	100	0.102	Contact Map	0.613
3zf6A	1	0.9272	100	0.105	Contact Map	0.604
3tqzA	1	0.9007	100	0.105	Contact Map	0.603
1euwA	1	0.8874	100	0.105	Contact Map	0.626
3mdxA	1	0.894	100	0.107	Contact Map	0.612
4gv8A	6	0.8477	100	0.114	Contact Map	0.825
3t64A	3	0.9404	100	0.115	Contact Map	0.697
3f4fA	3	0.9073	100	0.13	Contact Map	0.855
3araA	3	0.8278	100	0.135	Contact Map	0.862
3c2tA	2	0.8278	100	0.135	Contact Map	0.603

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.2174 seconds.