OPENSEQ.org - MIOC - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

MIOC - Protein MioC

UniProt:	P03817	Sequence MADITLISGSTLGGAEYVAEHLAEKLEEAGFTTETLHGPLLEDLPASGIWLVISSTHGAGDIPDNLSPFYEALQEQKPDLSAVRFGAIGIGSREYDTFCGAIDKLEAELKNSGAKQTGETLKINILDHDIPEDPAEEWLGSWVNLLK	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11199
Length:	147 (146)
Sequences:	2666
Seq/Len:	18.26

MIOC
Paralog alert: 0.55 [within 20: 0.04] - ratio of genomes with paralogs
Cluster includes: FLAV FLAW MIOC YQCA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
89_G	102_I	4.015	1.00
106_E	116_Q	3.566	1.00
84_R	115_K	3.526	1.00
103_D	122_K	3.204	1.00
100_G	104_K	2.871	1.00
108_E	112_S	2.659	1.00
11_T	64_D	2.626	1.00
108_E	111_N	2.514	1.00
110_K	116_Q	2.37	1.00
16_E	20_E	2.287	1.00
87_A	102_I	1.957	1.00
88_I	123_I	1.916	1.00
6_L	23_A	1.906	1.00
23_A	27_E	1.892	1.00
74_Q	108_E	1.881	1.00
85_F	110_K	1.829	1.00
85_F	106_E	1.772	1.00
23_A	35_T	1.768	1.00
4_I	26_L	1.736	1.00
58_G	61_D	1.735	1.00
26_L	143_V	1.652	1.00
109_L	114_A	1.58	1.00
49_I	84_R	1.55	1.00
9_G	66_L	1.544	1.00
9_G	54_S	1.536	1.00
106_E	110_K	1.528	1.00
106_E	120_T	1.528	1.00
118_G	141_S	1.504	1.00
53_I	88_I	1.485	1.00
62_I	101_A	1.441	1.00
15_A	53_I	1.438	1.00
85_F	116_Q	1.433	1.00
10_S	65_N	1.418	1.00
52_V	109_L	1.371	0.99
54_S	105_L	1.349	0.99
9_G	65_N	1.336	0.99
67_S	71_E	1.331	0.99
18_V	135_A	1.325	0.99
51_L	142_W	1.32	0.99
22_L	53_I	1.273	0.99
141_S	144_N	1.261	0.99
86_G	142_W	1.241	0.98
23_A	33_T	1.229	0.98
91_G	124_N	1.208	0.98
109_L	116_Q	1.199	0.98
103_D	120_T	1.199	0.98
82_A	115_K	1.19	0.98
107_A	111_N	1.167	0.97
7_I	50_W	1.161	0.97
70_Y	104_K	1.151	0.97
70_Y	105_L	1.151	0.97
123_I	135_A	1.15	0.97
43_D	46_A	1.144	0.97
85_F	114_A	1.136	0.97
5_T	34_E	1.133	0.97
50_W	83_V	1.12	0.96
58_G	94_E	1.115	0.96
10_S	15_A	1.108	0.96
61_D	104_K	1.107	0.96
88_I	121_L	1.106	0.96
40_L	43_D	1.104	0.96
86_G	118_G	1.094	0.96
142_W	146_L	1.09	0.96
3_D	32_T	1.083	0.96
5_T	47_S	1.068	0.95
56_T	60_G	1.066	0.95
55_S	63_P	1.062	0.95
99_C	102_I	1.057	0.95
116_Q	119_E	1.042	0.94
9_G	63_P	1.034	0.94
137_E	141_S	1.026	0.94
25_K	139_L	1.025	0.93
52_V	105_L	1.023	0.93
26_L	33_T	1.008	0.93
22_L	51_L	1.005	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1tllA	2	0.9796	100	0.144	Contact Map	0.813
2bpoA	2	0.9932	100	0.185	Contact Map	0.744
3qe2A	2	0.9864	100	0.188	Contact Map	0.844
3hr4A	4	0.9796	100	0.251	Contact Map	0.87
1bvyF	1	0.9796	100	0.321	Contact Map	0.74
4h2dA	2	1	100	0.328	Contact Map	0.856
2hnaA	1	1	100	0.33	Contact Map	0.52
1ykgA	1	0.9728	100	0.337	Contact Map	0.81
2wc1A	1	0.9796	99.9	0.372	Contact Map	0.641
1ag9A	2	0.966	99.9	0.388	Contact Map	0.784

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.3747 seconds.